>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
		  1 qikdllvsss tdldttlvlv naiyfkgmwk tafnaedtre mpfhvtkqes kpvqmmcmnn
		 61 sfnvatlpae kmkilelpfa sgdlsmlvll pdevsdleri ektinfeklt ewtn
>Sequence1
    ;This is a comment.
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGEVAAQL

; Attention: Pasting more than 100 000 lines (or very LONG lines) might result in an unresponsive browser.
; You might only see a blank input but can check your task manager to see that it is still working.
; Example on a low-end machine with firefox, 230 000 lines, 35 000 Proteins:
;  - Pasting the fasta to firefox: 5 seconds.
;  - "Fasta to Excel": 35 seconds
;  - "Excel to Fasta": 5 seconds

; FASTA to Excel:
;  - Removes linebreaks
;  - Removes indenting (tabs, spaces)
;  - Removes > from the ID
;  - Removes comment lines
;  - Adds Tabstop between ID and sequence for easy copy/paste to Excel

; Excel to Fasta:
;  - Removes empty lines
;  - Adds > to the ID, if none present
;  - Replaces TAB with NEWLINE
;  - Breaks sequences after 80 characters

Fasta ↔ ExcelBack to the toolbox